Lineage for d1o5ja1 (1o5j A:1-101)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2517841Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2517991Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 protein domains)
  6. 2518071Protein Hypothetical protein TM1056 [75435] (1 species)
  7. 2518072Species Thermotoga maritima [TaxId:2336] [75436] (3 PDB entries)
  8. 2518074Domain d1o5ja1: 1o5j A:1-101 [92503]
    Other proteins in same PDB: d1o5ja2
    structural genomics

Details for d1o5ja1

PDB Entry: 1o5j (more details), 1.95 Å

PDB Description: Crystal structure of Periplasmic divalent cation tolerance protein (TM1056) from Thermotoga maritima at 1.95 A resolution
PDB Compounds: (A:) Periplasmic divalent cation tolerance protein

SCOPe Domain Sequences for d1o5ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5ja1 d.58.5.2 (A:1-101) Hypothetical protein TM1056 {Thermotoga maritima [TaxId: 2336]}
milvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaaifkttee
kekelyeelrklhpyetpaiftlkvenvlteymnwlresvl

SCOPe Domain Coordinates for d1o5ja1:

Click to download the PDB-style file with coordinates for d1o5ja1.
(The format of our PDB-style files is described here.)

Timeline for d1o5ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o5ja2