Lineage for d1o5hb_ (1o5h B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450388Fold a.191: Methenyltetrahydrofolate cyclohydrolase-like [101261] (1 superfamily)
    5 helices; bundle, closed, left-handed twist
  4. 450389Superfamily a.191.1: Methenyltetrahydrofolate cyclohydrolase-like [101262] (1 family) (S)
  5. 450390Family a.191.1.1: Methenyltetrahydrofolate cyclohydrolase-like [101263] (1 protein)
    COG3404
  6. 450391Protein Hypothetical protein TM1560 [101264] (1 species)
    putative serine cycle enzyme
  7. 450392Species Thermotoga maritima [TaxId:243274] [101265] (1 PDB entry)
  8. 450394Domain d1o5hb_: 1o5h B: [92498]
    structural genomics

Details for d1o5hb_

PDB Entry: 1o5h (more details), 2.8 Å

PDB Description: crystal structure of formiminotetrahydrofolate cyclodeaminase (tm1560) from thermotoga maritima at 2.80 a resolution

SCOP Domain Sequences for d1o5hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5hb_ a.191.1.1 (B:) Hypothetical protein TM1560 {Thermotoga maritima}
everlslkefcdmvaerkptpgggavgsvvgamacalaemvanftrkkkgyedvepemer
iveameearlklfdlakkdmeafekvmkaykssegelqnalkeaasvpmdvirvmkdlah
eleklaefgnknlasdtlnaadlchavfqvekvnvlinlkeisdetfrknmleeleeqea
qiegcyqrvkkmlegivw

SCOP Domain Coordinates for d1o5hb_:

Click to download the PDB-style file with coordinates for d1o5hb_.
(The format of our PDB-style files is described here.)

Timeline for d1o5hb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o5ha_