Lineage for d1o5ha_ (1o5h A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018564Fold a.191: Methenyltetrahydrofolate cyclohydrolase-like [101261] (1 superfamily)
    5 helices; bundle, closed, left-handed twist
  4. 2018565Superfamily a.191.1: Methenyltetrahydrofolate cyclohydrolase-like [101262] (1 family) (S)
    automatically mapped to Pfam PF04961
  5. 2018566Family a.191.1.1: Methenyltetrahydrofolate cyclohydrolase-like [101263] (1 protein)
    COG3404
  6. 2018567Protein Hypothetical protein TM1560 [101264] (1 species)
    putative serine cycle enzyme
  7. 2018568Species Thermotoga maritima [TaxId:2336] [101265] (1 PDB entry)
  8. 2018569Domain d1o5ha_: 1o5h A: [92497]
    structural genomics

Details for d1o5ha_

PDB Entry: 1o5h (more details), 2.8 Å

PDB Description: crystal structure of formiminotetrahydrofolate cyclodeaminase (tm1560) from thermotoga maritima at 2.80 a resolution
PDB Compounds: (A:) Formiminotetrahydrofolate cyclodeaminase

SCOPe Domain Sequences for d1o5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o5ha_ a.191.1.1 (A:) Hypothetical protein TM1560 {Thermotoga maritima [TaxId: 2336]}
everlslkefcdmvaerkptpgggavgsvvgamacalaemvanftrkkkgyedvepemer
iveameearlklfdlakkdmeafekvmkaykssegelqnalkeaasvpmdvirvmkdlah
eleklaefgnknlasdtlnaadlchavfqvekvnvlinlkeisdetfrknmleeleeqea
qiegcyqrvkkmlegivwss

SCOPe Domain Coordinates for d1o5ha_:

Click to download the PDB-style file with coordinates for d1o5ha_.
(The format of our PDB-style files is described here.)

Timeline for d1o5ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o5hb_