Lineage for d1o59a2 (1o59 A:194-343)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384530Family b.18.1.22: Allantoicase repeat [101588] (1 protein)
    automatically mapped to Pfam PF03561
  6. 2384531Protein Allantoicase [101589] (1 species)
    duplication: tandem repeat of two similar domains
  7. 2384532Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101590] (2 PDB entries)
    Yir029w
  8. 2384534Domain d1o59a2: 1o59 A:194-343 [92496]
    Other proteins in same PDB: d1o59a3
    structural genomics

Details for d1o59a2

PDB Entry: 1o59 (more details), 2.4 Å

PDB Description: crystal structure of allantoicase (yir029w) from saccharomyces cerevisiae at 2.40 a resolution
PDB Compounds: (A:) Allantoicase

SCOPe Domain Sequences for d1o59a2:

Sequence, based on SEQRES records: (download)

>d1o59a2 b.18.1.22 (A:194-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hiidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlg
ressfiekiivdtahfrgnfpqfitvegclkesessentgegtwvelvgksktgpdkehv
yeirksirvshvkltiipdggvkrirvwgy

Sequence, based on observed residues (ATOM records): (download)

>d1o59a2 b.18.1.22 (A:194-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hiidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlg
ressfiekiivdtahfrgnfpqfitvegclktwvelvgksktgpdkehvyeirksirvsh
vkltiipdggvkrirvwgy

SCOPe Domain Coordinates for d1o59a2:

Click to download the PDB-style file with coordinates for d1o59a2.
(The format of our PDB-style files is described here.)

Timeline for d1o59a2: