Lineage for d1o58a_ (1o58 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493418Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 493419Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 493420Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (7 proteins)
  6. 493503Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (2 species)
  7. 493513Species Thermotoga maritima [TaxId:243274] [75312] (1 PDB entry)
    TM0665
  8. 493514Domain d1o58a_: 1o58 A: [92491]

Details for d1o58a_

PDB Entry: 1o58 (more details), 1.8 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase (tm0665) from thermotoga maritima at 1.80 a resolution

SCOP Domain Sequences for d1o58a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima}
hhmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngive
ptsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgaveka
leisretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvl
kgffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeay
emarylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsil

SCOP Domain Coordinates for d1o58a_:

Click to download the PDB-style file with coordinates for d1o58a_.
(The format of our PDB-style files is described here.)

Timeline for d1o58a_: