SCOP 1.67: Domain d1o57b1: 1o57 B:1-74

Lineage for d1o57b1 (1o57 B:1-74)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein)

6. Protein N-terminal domain of Bacillus PurR [101022] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101023] (2 PDB entries)

8. Domain d1o57b1: 1o57 B:1-74 [92485]
   Other proteins in same PDB: d1o57a2, d1o57b2, d1o57c2, d1o57d2

Details for d1o57b1

PDB Entry: 1o57, 2.2 Å

PDB Description: crystal structure of the purine operon repressor of bacillus subtilis

SCOP Domain Sequences for d1o57b1:

Sequence; same for both SEQRES and ATOM records:

>d1o57b1 a.4.5.40 (B:1-74) N-terminal domain of Bacillus PurR {Bacillus subtilis}
mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll
tvpgaaggvkyipk

Timeline for d1o57b1:

• d1o57b1 is new in SCOP 1.67
  
• d1o57b1 appears in SCOP 1.69
  
• d1o57b1 appears in the current release, SCOPe 2.08