Class a: All alpha proteins [46456] (202 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) contains a small beta-sheet (wing) |
Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein) |
Protein N-terminal domain of Bacillus PurR [101022] (1 species) |
Species Bacillus subtilis [TaxId:1423] [101023] (2 PDB entries) |
Domain d1o57a1: 1o57 A:2-74 [92483] Other proteins in same PDB: d1o57a2, d1o57b2, d1o57c2, d1o57d2 |
PDB Entry: 1o57 (more details), 2.2 Å
SCOP Domain Sequences for d1o57a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o57a1 a.4.5.40 (A:2-74) N-terminal domain of Bacillus PurR {Bacillus subtilis} kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt vpgaaggvkyipk
Timeline for d1o57a1: