Lineage for d1o54a1 (1o54 A:2-263)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129582Family c.66.1.13: tRNA(1-methyladenosine) methyltransferase-like [64117] (5 protein domains)
    contains additional N-terminal beta-sandwich domain
  6. 2129589Protein Hypothetical protein TM0748 [102573] (1 species)
  7. 2129590Species Thermotoga maritima [TaxId:2336] [102574] (1 PDB entry)
  8. 2129591Domain d1o54a1: 1o54 A:2-263 [92482]
    Other proteins in same PDB: d1o54a2
    structural genomics
    complexed with cl

Details for d1o54a1

PDB Entry: 1o54 (more details), 1.65 Å

PDB Description: Crystal structure of SAM-dependent O-methyltransferase (TM0748) from Thermotoga maritima at 1.65 A resolution
PDB Compounds: (A:) SAM-dependent O-methyltransferase

SCOPe Domain Sequences for d1o54a1:

Sequence, based on SEQRES records: (download)

>d1o54a1 c.66.1.13 (A:2-263) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}
gkvadtlkpgdrvllsfedeseflvdlekdkklhthlgiidlnevfekgpgeiirtsagk
kgyilipslideimnmkrrtqivypkdssfiammldvkegdriidtgvgsgamcavlara
vgssgkvfayekreefaklaesnltkwgliervtikvrdisegfdekdvdalfldvpdpw
nyidkcwealkgggrfatvcpttnqvqetlkklqelpfirievweslfrpykpvperlrp
vdrmvahtaymifatkvcrree

Sequence, based on observed residues (ATOM records): (download)

>d1o54a1 c.66.1.13 (A:2-263) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}
gkvadtlkpgdrvllsfedeseflvdlekdkklhthlgiidlnevfekgpgeiirtsagk
kgyilipslideimnmkrtqivypkdssfiammldvkegdriidtgvgsgamcavlarav
gssgkvfayekreefaklaesnltkwgliervtikvrdisegfdekdvdalfldvpdpwn
yidkcwealkgggrfatvcpttnqvqetlkklqelpfirievweslfrpykpvperlrpv
drmvahtaymifatkvcrree

SCOPe Domain Coordinates for d1o54a1:

Click to download the PDB-style file with coordinates for d1o54a1.
(The format of our PDB-style files is described here.)

Timeline for d1o54a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o54a2