Lineage for d1o50a2 (1o50 A:77-145)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601742Fold d.37: CBS-domain [54630] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 601743Superfamily d.37.1: CBS-domain [54631] (1 family) (S)
  5. 601744Family d.37.1.1: CBS-domain [54632] (5 proteins)
    Pfam 00571; pairs of CBS domains dimerize to form a stable globular domain
  6. 601755Protein Hypothetical protein TM0935 [102895] (1 species)
  7. 601756Species Thermotoga maritima [TaxId:243274] [102896] (1 PDB entry)
  8. 601758Domain d1o50a2: 1o50 A:77-145 [92479]
    structural genomics

Details for d1o50a2

PDB Entry: 1o50 (more details), 1.87 Å

PDB Description: crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 a resolution

SCOP Domain Sequences for d1o50a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o50a2 d.37.1.1 (A:77-145) Hypothetical protein TM0935 {Thermotoga maritima}
smkrliaknaseimldpvyvhmdtpleealklmidnniqempvvdekgeivgdlnsleil
lalwkgrek

SCOP Domain Coordinates for d1o50a2:

Click to download the PDB-style file with coordinates for d1o50a2.
(The format of our PDB-style files is described here.)

Timeline for d1o50a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o50a1