SCOP 1.67: Domain d1o50a2: 1o50 A:77-145

Lineage for d1o50a2 (1o50 A:77-145)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (4 proteins)
   pairs of CBS domains dimerize to form a stable globular domain

6. Protein Hypothetical protein TM0935 [102895] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [102896] (1 PDB entry)

8. Domain d1o50a2: 1o50 A:77-145 [92479]
   structural genomics

Details for d1o50a2

PDB Entry: 1o50, 1.87 Å

PDB Description: crystal structure of a cbs domain-containing protein (tm0935) from thermotoga maritima at 1.87 a resolution

SCOP Domain Sequences for d1o50a2:

Sequence; same for both SEQRES and ATOM records:

>d1o50a2 d.37.1.1 (A:77-145) Hypothetical protein TM0935 {Thermotoga maritima}
smkrliaknaseimldpvyvhmdtpleealklmidnniqempvvdekgeivgdlnsleil
lalwkgrek

Timeline for d1o50a2:

• d1o50a2 is new in SCOP 1.67
  
• d1o50a2 appears in SCOP 1.69
  
• d1o50a2 last appears in SCOP 1.73