Lineage for d1o4zc_ (1o4z C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371528Family b.29.1.2: beta-Glucanase-like [49925] (4 proteins)
  6. 371549Protein beta-Agarase A [101636] (1 species)
  7. 371550Species Zobellia galactanivorans [TaxId:63186] [101637] (3 PDB entries)
  8. 371555Domain d1o4zc_: 1o4z C: [92476]

Details for d1o4zc_

PDB Entry: 1o4z (more details), 2.3 Å

PDB Description: the three-dimensional structure of beta-agarase b from zobellia galactanivorans

SCOP Domain Sequences for d1o4zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4zc_ b.29.1.2 (C:) beta-Agarase A {Zobellia galactanivorans}
vdwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltew
krdrsyvadgelkmwatrkpgsdkinmgcitsktrvvypvyiearakvmnstlasdvwll
saddtqeidileaygadysesagkdhsyfskkvhishhvfirdpfqdyqpkdagswfedg
tvwnkefhrfgvywrdpwhleyyidgvlvrtvsgkdiidpkhftnttdpgnteidtrtgl
nkemdiiintedqtwrsspasglqsntytptdnelsnienntfgvdwiriykpvek

SCOP Domain Coordinates for d1o4zc_:

Click to download the PDB-style file with coordinates for d1o4zc_.
(The format of our PDB-style files is described here.)

Timeline for d1o4zc_: