Lineage for d1o4xb_ (1o4x B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440137Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 440138Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 440139Family a.21.1.1: HMG-box [47096] (9 proteins)
  6. 440178Protein Sox-2 [81718] (2 species)
  7. 440179Species Human (Homo sapiens) [TaxId:9606] [101105] (1 PDB entry)
  8. 440180Domain d1o4xb_: 1o4x B: [92472]
    Other proteins in same PDB: d1o4xa1, d1o4xa2

Details for d1o4xb_

PDB Entry: 1o4x (more details)

PDB Description: ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element

SCOP Domain Sequences for d1o4xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4xb_ a.21.1.1 (B:) Sox-2 {Human (Homo sapiens)}
drvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlr
alhmkehpdykyrprrk

SCOP Domain Coordinates for d1o4xb_:

Click to download the PDB-style file with coordinates for d1o4xb_.
(The format of our PDB-style files is described here.)

Timeline for d1o4xb_: