Lineage for d1o4xa2 (1o4x A:5-79)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537256Family a.35.1.1: POU-specific domain [47414] (3 proteins)
  6. 537261Protein Oct-1 [47415] (1 species)
    canonical 4-helical fold
  7. 537262Species Human (Homo sapiens) [TaxId:9606] [47416] (7 PDB entries)
  8. 537270Domain d1o4xa2: 1o4x A:5-79 [92471]
    Other proteins in same PDB: d1o4xa1, d1o4xb_
    mutant

Details for d1o4xa2

PDB Entry: 1o4x (more details)

PDB Description: ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element

SCOP Domain Sequences for d1o4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4xa2 a.35.1.1 (A:5-79) Oct-1 {Human (Homo sapiens)}
eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
aklkpllekwlndae

SCOP Domain Coordinates for d1o4xa2:

Click to download the PDB-style file with coordinates for d1o4xa2.
(The format of our PDB-style files is described here.)

Timeline for d1o4xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o4xa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1o4xb_