Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Oct-1 POU Homeodomain [46699] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries) |
Domain d1o4xa1: 1o4x A:110-163 [92470] Other proteins in same PDB: d1o4xa2, d1o4xb_ protein/DNA complex |
PDB Entry: 1o4x (more details)
SCOPe Domain Sequences for d1o4xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o4xa1 a.4.1.1 (A:110-163) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} sietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrin
Timeline for d1o4xa1: