SCOPe 2.06: Domain d1o4xa1: 1o4x A:110-163

Lineage for d1o4xa1 (1o4x A:110-163)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Oct-1 POU Homeodomain [46699] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)

8. Domain d1o4xa1: 1o4x A:110-163 [92470]
   Other proteins in same PDB: d1o4xa2, d1o4xb_
   protein/DNA complex

Details for d1o4xa1

PDB Entry: 1o4x

PDB Description: ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element

PDB Compounds: (A:) transcription factor Oct-1

SCOPe Domain Sequences for d1o4xa1:

Sequence; same for both SEQRES and ATOM records:

>d1o4xa1 a.4.1.1 (A:110-163) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]}
sietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrin

Timeline for d1o4xa1:

• d1o4xa1 first appeared in SCOP 1.67
  
• d1o4xa1 appears in SCOPe 2.05
  
• d1o4xa1 appears in SCOPe 2.07
  
• d1o4xa1 appears in the current release, SCOPe 2.08