Lineage for d1o4xa1 (1o4x A:110-163)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438100Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 438101Family a.4.1.1: Homeodomain [46690] (23 proteins)
  6. 438185Protein Oct-1 POU Homeodomain [46699] (1 species)
  7. 438186Species Human (Homo sapiens) [TaxId:9606] [46700] (7 PDB entries)
  8. 438194Domain d1o4xa1: 1o4x A:110-163 [92470]
    Other proteins in same PDB: d1o4xa2, d1o4xb_

Details for d1o4xa1

PDB Entry: 1o4x (more details)

PDB Description: ternary complex of the dna binding domains of the oct1 and sox2 transcription factors with a 19mer oligonucleotide from the hoxb1 regulatory element

SCOP Domain Sequences for d1o4xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4xa1 a.4.1.1 (A:110-163) Oct-1 POU Homeodomain {Human (Homo sapiens)}
sietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekrin

SCOP Domain Coordinates for d1o4xa1:

Click to download the PDB-style file with coordinates for d1o4xa1.
(The format of our PDB-style files is described here.)

Timeline for d1o4xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o4xa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1o4xb_