Lineage for d1o4ha_ (1o4h A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 508336Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 508337Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 508338Family d.93.1.1: SH2 domain [55551] (30 proteins)
    Pfam 00017
  6. 508352Protein c-src tyrosine kinase [55556] (3 species)
  7. 508357Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries)
  8. 508397Domain d1o4ha_: 1o4h A: [92459]

Details for d1o4ha_

PDB Entry: 1o4h (more details), 2.25 Å

PDB Description: crystal structure of sh2 in complex with ru79072.

SCOP Domain Sequences for d1o4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4ha_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt

SCOP Domain Coordinates for d1o4ha_:

Click to download the PDB-style file with coordinates for d1o4ha_.
(The format of our PDB-style files is described here.)

Timeline for d1o4ha_: