![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (28 proteins) |
![]() | Protein c-src tyrosine kinase [55556] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries) |
![]() | Domain d1o4ha_: 1o4h A: [92459] complexed with 772 |
PDB Entry: 1o4h (more details), 2.25 Å
SCOP Domain Sequences for d1o4ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o4ha_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)} siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt
Timeline for d1o4ha_: