SCOP 1.67: Domain d1o4ga_: 1o4g A:

Lineage for d1o4ga_ (1o4g A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (28 proteins)

6. Protein c-src tyrosine kinase [55556] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries)

8. Domain d1o4ga_: 1o4g A: [92458]
   complexed with i59

Details for d1o4ga_

PDB Entry: 1o4g, 1.55 Å

PDB Description: crystal structure of sh2 in complex with dpi59.

SCOP Domain Sequences for d1o4ga_:

Sequence; same for both SEQRES and ATOM records:

>d1o4ga_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt

Timeline for d1o4ga_:

• d1o4ga_ is new in SCOP 1.67
  
• d1o4ga_ appears in SCOP 1.69
  
• d1o4ga_ appears in the current release, SCOPe 2.08