Lineage for d1o4aa_ (1o4a A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608035Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 608036Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 608037Family d.93.1.1: SH2 domain [55551] (31 proteins)
    Pfam 00017
  6. 608054Protein c-src tyrosine kinase [55556] (3 species)
  7. 608059Species Human (Homo sapiens) [TaxId:9606] [55557] (40 PDB entries)
  8. 608063Domain d1o4aa_: 1o4a A: [92452]
    complexed with 197

Details for d1o4aa_

PDB Entry: 1o4a (more details), 1.5 Å

PDB Description: crystal structure of sh2 in complex with ru82197.

SCOP Domain Sequences for d1o4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4aa_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens)}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt

SCOP Domain Coordinates for d1o4aa_:

Click to download the PDB-style file with coordinates for d1o4aa_.
(The format of our PDB-style files is described here.)

Timeline for d1o4aa_: