SCOPe 2.06: Domain d1o0ha_: 1o0h A:

Lineage for d1o0ha_ (1o0h A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)

8. Domain d1o0ha_: 1o0h A: [92397]
   complexed with adp

Details for d1o0ha_

PDB Entry: 1o0h, 1.2 Å

PDB Description: ribonuclease a in complex with 5'-adp

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d1o0ha_:

Sequence; same for both SEQRES and ATOM records:

>d1o0ha_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1o0ha_:

• d1o0ha_ first appeared in SCOP 1.67
  
• d1o0ha_ appears in SCOPe 2.05
  
• d1o0ha_ appears in SCOPe 2.07
  
• d1o0ha_ appears in the current release, SCOPe 2.08