SCOPe 2.08: Domain d1o0eb_: 1o0e B:

Lineage for d1o0eb_ (1o0e B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Ervatamin C [102717] (1 species)

7. Species East indian rosebay (Ervatamia coronaria) [TaxId:52861] [102718] (1 PDB entry)

8. Domain d1o0eb_: 1o0e B: [92394]
   complexed with thj

Details for d1o0eb_

PDB Entry: 1o0e, 1.9 Å

PDB Description: 1.9 Angstrom Crystal Structure of a plant cysteine protease Ervatamin C

PDB Compounds: (B:) Ervatamin C

SCOPe Domain Sequences for d1o0eb_:

Sequence; same for both SEQRES and ATOM records:

>d1o0eb_ d.3.1.1 (B:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]}
lpeqidwrkkgavtpvknqgscgscwafstvstvesinqirtgnlislseqelvdcdkkn
hgclggafvfayqyiinnggidtqanypykavqgpcqaaskvvsidgyngvpfcnexalk
qavavqpstvaidassaqfqqyssgifsgpcgtklnhgvtivgyqanywivrnswgrywg
ekgyirmlrvggcglcgiarlpyyptka

Timeline for d1o0eb_:

• d1o0eb_ first appeared in SCOP 1.67
  
• d1o0eb_ appears in SCOPe 2.07