![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein Ervatamin C [102717] (1 species) |
![]() | Species East indian rosebay (Ervatamia coronaria) [TaxId:52861] [102718] (1 PDB entry) |
![]() | Domain d1o0ea_: 1o0e A: [92393] complexed with thj |
PDB Entry: 1o0e (more details), 1.9 Å
SCOPe Domain Sequences for d1o0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} lpeqidwrkkgavtpvknqgscgscwafstvstvesinqirtgnlislseqelvdcdkkn hgclggafvfayqyiinnggidtqanypykavqgpcqaaskvvsidgyngvpfcnexalk qavavqpstvaidassaqfqqyssgifsgpcgtklnhgvtivgyqanywivrnswgrywg ekgyirmlrvggcglcgiarlpyyptka
Timeline for d1o0ea_: