Lineage for d1o0d.1 (1o0d L:,H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056594Protein Thrombin [50531] (2 species)
  7. 2056630Species Human (Homo sapiens) [TaxId:9606] [50532] (170 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2056771Domain d1o0d.1: 1o0d L:,H: [92392]
    complexed with 163

Details for d1o0d.1

PDB Entry: 1o0d (more details), 2.44 Å

PDB Description: human thrombin complexed with a d-phe-pro-arg-type inhibitor and a c- terminal hirudin derived exo-site inhibitor
PDB Compounds: (H:) Thrombin heavy chain, (L:) Thrombin light chain

SCOPe Domain Sequences for d1o0d.1:

Sequence, based on SEQRES records: (download)

>g1o0d.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
gsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspqe
llcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiy
ihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlk
etwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegds
ggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

Sequence, based on observed residues (ATOM records): (download)

>g1o0d.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
gsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspqe
llcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiy
ihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlk
etgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmk
spfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

SCOPe Domain Coordinates for d1o0d.1:

Click to download the PDB-style file with coordinates for d1o0d.1.
(The format of our PDB-style files is described here.)

Timeline for d1o0d.1: