SCOPe 2.07: Domain d1nzpa_: 1nzp A:

Lineage for d1nzpa_ (1nzp A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)

8. Domain d1nzpa_: 1nzp A: [92385]
   one (lyase) domain only
   protein/DNA complex

Details for d1nzpa_

PDB Entry: 1nzp

PDB Description: solution structure of the lyase domain of human dna polymerase lambda

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d1nzpa_:

Sequence; same for both SEQRES and ATOM records:

>d1nzpa_ a.60.6.1 (A:) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
ipgigkrmaekiieilesghlrkldh

Timeline for d1nzpa_:

• d1nzpa_ first appeared in SCOP 1.67
  
• d1nzpa_ appears in SCOPe 2.06
  
• d1nzpa_ appears in the current release, SCOPe 2.08