Lineage for d1nzpa_ (1nzp A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 771080Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 771081Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 771205Protein DNA polymerase lambda [101251] (1 species)
  7. 771206Species Human (Homo sapiens) [TaxId:9606] [101252] (17 PDB entries)
  8. 771234Domain d1nzpa_: 1nzp A: [92385]
    one (lyase) domain only

Details for d1nzpa_

PDB Entry: 1nzp (more details)

PDB Description: solution structure of the lyase domain of human dna polymerase lambda
PDB Compounds: (A:) DNA polymerase lambda

SCOP Domain Sequences for d1nzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzpa_ a.60.6.1 (A:) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
ipgigkrmaekiieilesghlrkldh

SCOP Domain Coordinates for d1nzpa_:

Click to download the PDB-style file with coordinates for d1nzpa_.
(The format of our PDB-style files is described here.)

Timeline for d1nzpa_: