Lineage for d1nzna_ (1nzn A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096244Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1096245Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 1096276Protein Mitochondria fission protein Fis1 [101417] (2 species)
  7. 1096282Species Human (Homo sapiens) [TaxId:9606] [101418] (2 PDB entries)
  8. 1096283Domain d1nzna_: 1nzn A: [92382]
    complexed with gol, so4

Details for d1nzna_

PDB Entry: 1nzn (more details), 2 Å

PDB Description: Cytosolic domain of the human mitchondrial fission protein Fis1 adopts a TPR fold
PDB Compounds: (A:) Fission protein Fis1p

SCOPe Domain Sequences for d1nzna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}
hmeavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrtrynddirkgivlle
ellpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamk
kd

SCOPe Domain Coordinates for d1nzna_:

Click to download the PDB-style file with coordinates for d1nzna_.
(The format of our PDB-style files is described here.)

Timeline for d1nzna_: