Lineage for d1nzja_ (1nzj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105415Protein Glutamyl-Q tRNA-Asp synthetase YadB [102257] (1 species)
    truncated GluRS and GlnRS homologue lacking the anticodon-binding domain; glutamylates the modified base queuosine (Q) of tRNA-Asp
  7. 2105416Species Escherichia coli [TaxId:562] [102258] (3 PDB entries)
  8. 2105417Domain d1nzja_: 1nzj A: [92377]
    structural genomics
    complexed with zn

Details for d1nzja_

PDB Entry: 1nzj (more details), 1.5 Å

PDB Description: crystal structure and activity studies of escherichia coli yadb orf
PDB Compounds: (A:) Hypothetical protein yadB

SCOPe Domain Sequences for d1nzja_:

Sequence, based on SEQRES records: (download)

>d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]}
tqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilrq
lehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvlh
hgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhfq
gvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqnhapalpkgdp
rpvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaiv

Sequence, based on observed residues (ATOM records): (download)

>d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]}
tqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilrq
lehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvlh
hgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhfq
gvteivrgadlieptvrqislyqlfgwkvpdyihlplalnalpkgdprpvliaalqflgq
qaeahwqdfsveqilqsavknwrltavpesaiv

SCOPe Domain Coordinates for d1nzja_:

Click to download the PDB-style file with coordinates for d1nzja_.
(The format of our PDB-style files is described here.)

Timeline for d1nzja_: