![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein Glutamyl-Q tRNA-Asp synthetase YadB [102257] (1 species) truncated GluRS and GlnRS homologue lacking the anticodon-binding domain; glutamylates the modified base queuosine (Q) of tRNA-Asp |
![]() | Species Escherichia coli [TaxId:562] [102258] (3 PDB entries) |
![]() | Domain d1nzja_: 1nzj A: [92377] structural genomics complexed with zn |
PDB Entry: 1nzj (more details), 1.5 Å
SCOPe Domain Sequences for d1nzja_:
Sequence, based on SEQRES records: (download)
>d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} tqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilrq lehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvlh hgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhfq gvteivrgadlieptvrqislyqlfgwkvpdyihlplalnpqgaklskqnhapalpkgdp rpvliaalqflgqqaeahwqdfsveqilqsavknwrltavpesaiv
>d1nzja_ c.26.1.1 (A:) Glutamyl-Q tRNA-Asp synthetase YadB {Escherichia coli [TaxId: 562]} tqyigrfapspsgelhfgsliaalgsylqararqgrwlvriedidpprevpgaaetilrq lehyglhwdgdvlwqsqrhdayrealawlheqglsyyctctrariqsiggiydghcrvlh hgpdnaavrirqqhpvtqftdqlrgiihadeklaredfiihrrdglfaynlavvvddhfq gvteivrgadlieptvrqislyqlfgwkvpdyihlplalnalpkgdprpvliaalqflgq qaeahwqdfsveqilqsavknwrltavpesaiv
Timeline for d1nzja_: