Lineage for d1nzha_ (1nzh A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419845Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 419846Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 419869Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (2 proteins)
  6. 419870Protein Salivary nitrophorin [103310] (1 species)
    heme-binding homologue of IPP5
  7. 419871Species Bedbug (Cimex lectularius) [TaxId:79782] [103311] (2 PDB entries)
  8. 419873Domain d1nzha_: 1nzh A: [92376]
    complexed with hem, nmo, trs

Details for d1nzha_

PDB Entry: 1nzh (more details), 1.75 Å

PDB Description: Crystal Structure of Cimex Nitrophorin NO Complex

SCOP Domain Sequences for d1nzha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzha_ d.151.1.2 (A:) Salivary nitrophorin {Bedbug (Cimex lectularius)}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOP Domain Coordinates for d1nzha_:

Click to download the PDB-style file with coordinates for d1nzha_.
(The format of our PDB-style files is described here.)

Timeline for d1nzha_: