Lineage for d1nzea_ (1nze A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700604Superfamily a.24.18: Oxygen-evolving enhancer protein 3, [101112] (1 family) (S)
    automatically mapped to Pfam PF05757
  5. 2700605Family a.24.18.1: Oxygen-evolving enhancer protein 3, [101113] (1 protein)
  6. 2700606Protein Oxygen-evolving enhancer protein 3, [101114] (1 species)
    PsbQ protein of photosystem II
  7. 2700607Species Spinach (Spinacia oleracea) [TaxId:3562] [101115] (1 PDB entry)
  8. 2700608Domain d1nzea_: 1nze A: [92374]
    complexed with zn

Details for d1nzea_

PDB Entry: 1nze (more details), 1.95 Å

PDB Description: Crystal structure of PsbQ polypeptide of photosystem II from higher plants
PDB Compounds: (A:) Oxygen-evolving enhancer protein 3

SCOPe Domain Sequences for d1nzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzea_ a.24.18.1 (A:) Oxygen-evolving enhancer protein 3, {Spinach (Spinacia oleracea) [TaxId: 3562]}
fylqplppteaaqrakvsaseilnvkqfidrkawpslqndlrlrasylrydlktvisakp
kdekkslqeltsklfssidnldhaakikspteaekyygqtvsninevlaklg

SCOPe Domain Coordinates for d1nzea_:

Click to download the PDB-style file with coordinates for d1nzea_.
(The format of our PDB-style files is described here.)

Timeline for d1nzea_: