Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.18: Oxygen-evolving enhancer protein 3, [101112] (1 family) automatically mapped to Pfam PF05757 |
Family a.24.18.1: Oxygen-evolving enhancer protein 3, [101113] (1 protein) |
Protein Oxygen-evolving enhancer protein 3, [101114] (1 species) PsbQ protein of photosystem II |
Species Spinach (Spinacia oleracea) [TaxId:3562] [101115] (1 PDB entry) |
Domain d1nzea_: 1nze A: [92374] complexed with zn |
PDB Entry: 1nze (more details), 1.95 Å
SCOPe Domain Sequences for d1nzea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzea_ a.24.18.1 (A:) Oxygen-evolving enhancer protein 3, {Spinach (Spinacia oleracea) [TaxId: 3562]} fylqplppteaaqrakvsaseilnvkqfidrkawpslqndlrlrasylrydlktvisakp kdekkslqeltsklfssidnldhaakikspteaekyygqtvsninevlaklg
Timeline for d1nzea_: