Lineage for d1nzda_ (1nzd A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1183918Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 1183919Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) (S)
  5. 1183920Family c.87.1.1: beta-Glucosyltransferase (DNA-modifying) [53757] (1 protein)
  6. 1183921Protein beta-Glucosyltransferase (DNA-modifying) [53758] (1 species)
  7. 1183922Species Bacteriophage T4 [TaxId:10665] [53759] (20 PDB entries)
    Uniprot P04547
  8. 1183933Domain d1nzda_: 1nzd A: [92373]
    complexed with cl, gol, upg; mutant

Details for d1nzda_

PDB Entry: 1nzd (more details), 2 Å

PDB Description: t4 phage bgt-d100a mutant in complex with udp-glucose: form i
PDB Compounds: (A:) DNA beta-glycosyltransferase

SCOPe Domain Sequences for d1nzda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzda_ c.87.1.1 (A:) beta-Glucosyltransferase (DNA-modifying) {Bacteriophage T4 [TaxId: 10665]}
mkiaiinmgnnvinfktvpssetiylfkvisemglnvdiislkngvytksfdevdvndyd
rlivvnssinffggkpnlailsaqkfmakykskiyylftairlpfsqswpnvknrpwayl
yteeellikspikvisqginldiakaahkkvdnviefeyfpieqykihmndfqlskptkk
tldviyggsfrsgqreskmveflfdtglnieffgnarekqfknpkypwtkapvftgkipm
nmvseknsqaiaaliigdknyndnfitlrvwetmasdavmlideefdtkhriindarfyv
nnraelidrvnelkhsdvlrkemlsiqhdilnktrakkaewqdafkkaidl

SCOPe Domain Coordinates for d1nzda_:

Click to download the PDB-style file with coordinates for d1nzda_.
(The format of our PDB-style files is described here.)

Timeline for d1nzda_: