SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1nzbf1 (1nzb F:20-129)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999381Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 1999382Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 protein domains)
  6. 1999383Protein Cre recombinase [47825] (1 species)
  7. 1999384Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1999422Domain d1nzbf1: 1nzb F:20-129 [92371]
    Other proteins in same PDB: d1nzba2, d1nzbb2, d1nzbe2, d1nzbf2
    protein/DNA complex; complexed with iod, mg

Details for d1nzbf1

PDB Entry: 1nzb (more details), 3.1 Å

PDB Description: Crystal structure of wild type Cre recombinase-loxP synapse
PDB Compounds: (F:) cre recombinase

SCOPe Domain Sequences for d1nzbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzbf1 a.60.9.1 (F:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d1nzbf1:

Click to download the PDB-style file with coordinates for d1nzbf1.
(The format of our PDB-style files is described here.)

Timeline for d1nzbf1: