Lineage for d1nzbf1 (1nzb F:20-129)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999381Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) (S)
  5. 1999382Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 protein domains)
  6. 1999383Protein Cre recombinase [47825] (1 species)
  7. 1999384Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
    Uniprot P06956 20-341
  8. 1999422Domain d1nzbf1: 1nzb F:20-129 [92371]
    Other proteins in same PDB: d1nzba2, d1nzbb2, d1nzbe2, d1nzbf2
    protein/DNA complex; complexed with iod, mg

Details for d1nzbf1

PDB Entry: 1nzb (more details), 3.1 Å

PDB Description: Crystal structure of wild type Cre recombinase-loxP synapse
PDB Compounds: (F:) cre recombinase

SCOPe Domain Sequences for d1nzbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzbf1 a.60.9.1 (F:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOPe Domain Coordinates for d1nzbf1:

Click to download the PDB-style file with coordinates for d1nzbf1.
(The format of our PDB-style files is described here.)

Timeline for d1nzbf1: