| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) ![]() |
| Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
| Protein Cre recombinase [47825] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [47826] (16 PDB entries) |
| Domain d1nzbb1: 1nzb B:20-129 [92367] Other proteins in same PDB: d1nzba2, d1nzbb2, d1nzbe2, d1nzbf2 |
PDB Entry: 1nzb (more details), 3.1 Å
SCOP Domain Sequences for d1nzbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzbb1 a.60.9.1 (B:20-129) Cre recombinase {Bacteriophage P1}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d1nzbb1: