Lineage for d1nz8a_ (1nz8 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 605120Superfamily d.58.42: N-utilization substance G protein NusG, N-terminal domain [82679] (1 family) (S)
  5. 605121Family d.58.42.1: N-utilization substance G protein NusG, N-terminal domain [82680] (1 protein)
  6. 605122Protein N-utilization substance G protein NusG, N-terminal domain [82681] (2 species)
  7. 605134Species Thermus thermophilus [TaxId:274] [102994] (1 PDB entry)
  8. 605135Domain d1nz8a_: 1nz8 A: [92363]
    N-terminal domain (Ngn) only

Details for d1nz8a_

PDB Entry: 1nz8 (more details)

PDB Description: Solution Structure of the N-utilization substance G (NusG) N-terminal (NGN) domain from Thermus thermophilus

SCOP Domain Sequences for d1nz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz8a_ d.58.42.1 (A:) N-utilization substance G protein NusG, N-terminal domain {Thermus thermophilus}
siewyavhtlvgqeekakanlekrikafglqdkifqvlipteevvelreggkkevvrkkl
fpgylfiqmdlgdeeepneawevvrgtpgitgfvgagmrpvplspdevrhilevsgllg

SCOP Domain Coordinates for d1nz8a_:

Click to download the PDB-style file with coordinates for d1nz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1nz8a_: