Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.42: N-utilization substance G protein NusG, N-terminal domain [82679] (1 family) |
Family d.58.42.1: N-utilization substance G protein NusG, N-terminal domain [82680] (1 protein) |
Protein N-utilization substance G protein NusG, N-terminal domain [82681] (2 species) |
Species Thermus thermophilus [TaxId:274] [102994] (1 PDB entry) |
Domain d1nz8a_: 1nz8 A: [92363] N-terminal domain (Ngn) only |
PDB Entry: 1nz8 (more details)
SCOP Domain Sequences for d1nz8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nz8a_ d.58.42.1 (A:) N-utilization substance G protein NusG, N-terminal domain {Thermus thermophilus} siewyavhtlvgqeekakanlekrikafglqdkifqvlipteevvelreggkkevvrkkl fpgylfiqmdlgdeeepneawevvrgtpgitgfvgagmrpvplspdevrhilevsgllg
Timeline for d1nz8a_: