Lineage for d1nyrb4 (1nyr B:242-532)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1214435Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1214436Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1214437Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1214627Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 1214646Species Staphylococcus aureus [TaxId:1280] [103154] (2 PDB entries)
  8. 1214648Domain d1nyrb4: 1nyr B:242-532 [92361]
    Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra3, d1nyrb1, d1nyrb2, d1nyrb3
    protein/RNA complex; complexed with atp, thr, zn

Details for d1nyrb4

PDB Entry: 1nyr (more details), 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP
PDB Compounds: (B:) threonyl-tRNA synthetase 1

SCOPe Domain Sequences for d1nyrb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyrb4 d.104.1.1 (B:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]}
dhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanv
dlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelg
tmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfr
lsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamg
keetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflt

SCOPe Domain Coordinates for d1nyrb4:

Click to download the PDB-style file with coordinates for d1nyrb4.
(The format of our PDB-style files is described here.)

Timeline for d1nyrb4: