Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins) |
Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [103154] (2 PDB entries) |
Domain d1nyrb4: 1nyr B:242-532 [92361] Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra3, d1nyrb1, d1nyrb2, d1nyrb3 complexed with atp, thr, zn |
PDB Entry: 1nyr (more details), 2.8 Å
SCOP Domain Sequences for d1nyrb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyrb4 d.104.1.1 (B:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus} dhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanv dlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelg tmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfr lsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamg keetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflt
Timeline for d1nyrb4:
View in 3D Domains from other chains: (mouse over for more information) d1nyra1, d1nyra2, d1nyra3, d1nyra4 |