![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [103154] (2 PDB entries) |
![]() | Domain d1nyrb4: 1nyr B:242-532 [92361] Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra3, d1nyrb1, d1nyrb2, d1nyrb3 protein/RNA complex; complexed with atp, thr, zn |
PDB Entry: 1nyr (more details), 2.8 Å
SCOPe Domain Sequences for d1nyrb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyrb4 d.104.1.1 (B:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} dhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanv dlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelg tmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfr lsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamg keetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflt
Timeline for d1nyrb4:
![]() Domains from other chains: (mouse over for more information) d1nyra1, d1nyra2, d1nyra3, d1nyra4 |