Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (2 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.1: TGS domain [81270] (1 protein) |
Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [102798] (2 PDB entries) |
Domain d1nyrb2: 1nyr B:1-62 [92359] Other proteins in same PDB: d1nyra1, d1nyra3, d1nyra4, d1nyrb1, d1nyrb3, d1nyrb4 complexed with atp, thr, zn |
PDB Entry: 1nyr (more details), 2.8 Å
SCOP Domain Sequences for d1nyrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyrb2 d.15.10.1 (B:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie iv
Timeline for d1nyrb2:
View in 3D Domains from other chains: (mouse over for more information) d1nyra1, d1nyra2, d1nyra3, d1nyra4 |