Lineage for d1nyrb2 (1nyr B:1-62)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 500316Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 500317Family d.15.10.1: TGS domain [81270] (1 protein)
  6. 500318Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)
  7. 500321Species Staphylococcus aureus [TaxId:1280] [102798] (2 PDB entries)
  8. 500323Domain d1nyrb2: 1nyr B:1-62 [92359]
    Other proteins in same PDB: d1nyra1, d1nyra3, d1nyra4, d1nyrb1, d1nyrb3, d1nyrb4

Details for d1nyrb2

PDB Entry: 1nyr (more details), 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP

SCOP Domain Sequences for d1nyrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyrb2 d.15.10.1 (B:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus}
meqiniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsie
iv

SCOP Domain Coordinates for d1nyrb2:

Click to download the PDB-style file with coordinates for d1nyrb2.
(The format of our PDB-style files is described here.)

Timeline for d1nyrb2: