Lineage for d1nyra4 (1nyr A:242-532)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416610Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 416611Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) (S)
  5. 416612Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (14 proteins)
  6. 416761Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 416780Species Staphylococcus aureus [TaxId:1280] [103154] (2 PDB entries)
  8. 416781Domain d1nyra4: 1nyr A:242-532 [92357]
    Other proteins in same PDB: d1nyra1, d1nyra2, d1nyra3, d1nyrb1, d1nyrb2, d1nyrb3

Details for d1nyra4

PDB Entry: 1nyr (more details), 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP

SCOP Domain Sequences for d1nyra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus}
dhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanv
dlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelg
tmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfr
lsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamg
keetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflt

SCOP Domain Coordinates for d1nyra4:

Click to download the PDB-style file with coordinates for d1nyra4.
(The format of our PDB-style files is described here.)

Timeline for d1nyra4: