Lineage for d1nyra1 (1nyr A:533-645)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371340Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1371341Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 1371342Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 1371427Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)
  7. 1371446Species Staphylococcus aureus [TaxId:1280] [102469] (2 PDB entries)
  8. 1371447Domain d1nyra1: 1nyr A:533-645 [92354]
    Other proteins in same PDB: d1nyra2, d1nyra3, d1nyra4, d1nyrb2, d1nyrb3, d1nyrb4
    protein/RNA complex; complexed with atp, thr, zn

Details for d1nyra1

PDB Entry: 1nyr (more details), 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP
PDB Compounds: (A:) threonyl-tRNA synthetase 1

SCOPe Domain Sequences for d1nyra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyra1 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
eetkgafptwlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykirea
qmqkipyqivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr

SCOPe Domain Coordinates for d1nyra1:

Click to download the PDB-style file with coordinates for d1nyra1.
(The format of our PDB-style files is described here.)

Timeline for d1nyra1: