Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [102469] (2 PDB entries) |
Domain d1nyra1: 1nyr A:533-645 [92354] Other proteins in same PDB: d1nyra2, d1nyra3, d1nyra4, d1nyrb2, d1nyrb3, d1nyrb4 protein/RNA complex; complexed with atp, thr, zn |
PDB Entry: 1nyr (more details), 2.8 Å
SCOPe Domain Sequences for d1nyra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyra1 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} eetkgafptwlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykirea qmqkipyqivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr
Timeline for d1nyra1:
View in 3D Domains from other chains: (mouse over for more information) d1nyrb1, d1nyrb2, d1nyrb3, d1nyrb4 |