Lineage for d1nyra1 (1nyr A:533-645)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 487574Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 487575Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 487576Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 487649Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)
  7. 487668Species Staphylococcus aureus [TaxId:1280] [102469] (2 PDB entries)
  8. 487669Domain d1nyra1: 1nyr A:533-645 [92354]
    Other proteins in same PDB: d1nyra2, d1nyra3, d1nyra4, d1nyrb2, d1nyrb3, d1nyrb4

Details for d1nyra1

PDB Entry: 1nyr (more details), 2.8 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with ATP

SCOP Domain Sequences for d1nyra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyra1 c.51.1.1 (A:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus}
eetkgafptwlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykirea
qmqkipyqivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr

SCOP Domain Coordinates for d1nyra1:

Click to download the PDB-style file with coordinates for d1nyra1.
(The format of our PDB-style files is described here.)

Timeline for d1nyra1: