Lineage for d1nyqb4 (1nyq B:242-532)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967618Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2967820Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 2967839Species Staphylococcus aureus [TaxId:1280] [103154] (2 PDB entries)
  8. 2967843Domain d1nyqb4: 1nyq B:242-532 [92353]
    Other proteins in same PDB: d1nyqa1, d1nyqa2, d1nyqa3, d1nyqb1, d1nyqb2, d1nyqb3
    protein/RNA complex; complexed with tsb, zn

Details for d1nyqb4

PDB Entry: 1nyq (more details), 3.2 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with an analogue of threonyl adenylate
PDB Compounds: (B:) threonyl-tRNA synthetase 1

SCOPe Domain Sequences for d1nyqb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyqb4 d.104.1.1 (B:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]}
dhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanv
dlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelg
tmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfr
lsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamg
keetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflt

SCOPe Domain Coordinates for d1nyqb4:

Click to download the PDB-style file with coordinates for d1nyqb4.
(The format of our PDB-style files is described here.)

Timeline for d1nyqb4: