SCOP 1.71: Domain d1nyqb1: 1nyq B:533-645

Lineage for d1nyqb1 (1nyq B:533-645)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Threonyl-tRNA synthetase (ThrRS), C-terminal domain [52962] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [102469] (2 PDB entries)

8. Domain d1nyqb1: 1nyq B:533-645 [92350]
   Other proteins in same PDB: d1nyqa2, d1nyqa3, d1nyqa4, d1nyqb2, d1nyqb3, d1nyqb4
   complexed with tsb, zn

Details for d1nyqb1

PDB Entry: 1nyq, 3.2 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with an analogue of threonyl adenylate

SCOP Domain Sequences for d1nyqb1:

Sequence; same for both SEQRES and ATOM records:

>d1nyqb1 c.51.1.1 (B:533-645) Threonyl-tRNA synthetase (ThrRS), C-terminal domain {Staphylococcus aureus}
eetkgafptwlapkqvqiipvnvdlhydyarqlqdelksqgvrvsiddrnekmgykirea
qmqkipyqivvgdkevennqvnvrqygsqdqetvekdefiwnlvdeirlkkhr

Timeline for d1nyqb1:

• d1nyqb1 first appeared in SCOP 1.67
  
• d1nyqb1 appears in SCOP 1.69
  
• d1nyqb1 appears in SCOP 1.73
  
• d1nyqb1 appears in the current release, SCOPe 2.08