Lineage for d1nyqa4 (1nyq A:242-532)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208547Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 2208749Protein Threonyl-tRNA synthetase (ThrRS) [55694] (2 species)
  7. 2208768Species Staphylococcus aureus [TaxId:1280] [103154] (2 PDB entries)
  8. 2208771Domain d1nyqa4: 1nyq A:242-532 [92349]
    Other proteins in same PDB: d1nyqa1, d1nyqa2, d1nyqa3, d1nyqb1, d1nyqb2, d1nyqb3
    protein/RNA complex; complexed with tsb, zn

Details for d1nyqa4

PDB Entry: 1nyq (more details), 3.2 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with an analogue of threonyl adenylate
PDB Compounds: (A:) threonyl-tRNA synthetase 1

SCOPe Domain Sequences for d1nyqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyqa4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]}
dhrkigkelelftnsqlvgaglplwlpngatirreieryivdkevsmgydhvytpvlanv
dlyktsghwdhyqedmfppmqldetesmvlrpmncphhmmiyankphsyrelpiriaelg
tmhryeasgavsglqrvrgmtlndshifvrpdqikeefkrvvnmiidvykdfgfedysfr
lsyrdpedkekyfddddmwnkaenmlkeaadelglsyeeaigeaafygpkldvqvktamg
keetlstaqldfllperfdltyigqdgehhrpvvihrgvvstmerfvaflt

SCOPe Domain Coordinates for d1nyqa4:

Click to download the PDB-style file with coordinates for d1nyqa4.
(The format of our PDB-style files is described here.)

Timeline for d1nyqa4: