| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (2 families) ![]() possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
| Family d.15.10.1: TGS domain [81270] (1 protein) |
| Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species) |
| Species Staphylococcus aureus [TaxId:1280] [102798] (2 PDB entries) |
| Domain d1nyqa2: 1nyq A:4-62 [92347] Other proteins in same PDB: d1nyqa1, d1nyqa3, d1nyqa4, d1nyqb1, d1nyqb3, d1nyqb4 |
PDB Entry: 1nyq (more details), 3.2 Å
SCOP Domain Sequences for d1nyqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyqa2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus}
iniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsieiv
Timeline for d1nyqa2:
View in 3DDomains from other chains: (mouse over for more information) d1nyqb1, d1nyqb2, d1nyqb3, d1nyqb4 |