Lineage for d1nyqa2 (1nyq A:4-62)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 408612Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif
  5. 408613Family d.15.10.1: TGS domain [81270] (1 protein)
  6. 408614Protein Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain [55176] (2 species)
  7. 408617Species Staphylococcus aureus [TaxId:1280] [102798] (2 PDB entries)
  8. 408620Domain d1nyqa2: 1nyq A:4-62 [92347]
    Other proteins in same PDB: d1nyqa1, d1nyqa3, d1nyqa4, d1nyqb1, d1nyqb3, d1nyqb4

Details for d1nyqa2

PDB Entry: 1nyq (more details), 3.2 Å

PDB Description: Structure of Staphylococcus aureus threonyl-tRNA synthetase complexed with an analogue of threonyl adenylate

SCOP Domain Sequences for d1nyqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyqa2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus}
iniqfpdgnkkafdkgtttediaqsispglrkkavagkfngqlvdltkpletdgsieiv

SCOP Domain Coordinates for d1nyqa2:

Click to download the PDB-style file with coordinates for d1nyqa2.
(The format of our PDB-style files is described here.)

Timeline for d1nyqa2: