SCOP 1.71: Domain d1nyoa_: 1nyo A:

Lineage for d1nyoa_ (1nyo A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.118: FAS1 domain [82152] (1 superfamily)
   core: barrel, closed; n=7, S=12; meander

4. Superfamily b.118.1: FAS1 domain [82153] (1 family)

5. Family b.118.1.1: FAS1 domain [82154] (2 proteins)

6. Protein Immunogenic protein MPT70 [101859] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [101860] (1 PDB entry)

8. Domain d1nyoa_: 1nyo A: [92345]

Details for d1nyoa_

PDB Entry: 1nyo

PDB Description: solution structure of the antigenic tb protein mpt70/mpb70

SCOP Domain Sequences for d1nyoa_:

Sequence; same for both SEQRES and ATOM records:

>d1nyoa_ b.118.1.1 (A:) Immunogenic protein MPT70 {Mycobacterium tuberculosis}
gdlvgpgcaeyaaanptgpasvqgmsqdpvavaasnnpelttltaalsgqlnpqvnlvdt
lnsgqytvfaptnaafsklpastidelktnsslltsiltyhvvagqtspanvvgtrqtlq
gasvtvtgqgnslkvgnadvvcggvstanatvymidsvlmppa

Timeline for d1nyoa_:

• d1nyoa_ first appeared in SCOP 1.67
  
• d1nyoa_ appears in SCOP 1.69
  
• d1nyoa_ appears in SCOP 1.73
  
• d1nyoa_ appears in the current release, SCOPe 2.08