Lineage for d1nyoa_ (1nyo A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472260Fold b.118: FAS1 domain [82152] (1 superfamily)
    core: barrel, closed; n=7, S=12; meander
  4. 472261Superfamily b.118.1: FAS1 domain [82153] (1 family) (S)
  5. 472262Family b.118.1.1: FAS1 domain [82154] (2 proteins)
  6. 472267Protein Immunogenic protein MPT70 [101859] (1 species)
  7. 472268Species Mycobacterium tuberculosis [TaxId:1773] [101860] (1 PDB entry)
  8. 472269Domain d1nyoa_: 1nyo A: [92345]

Details for d1nyoa_

PDB Entry: 1nyo (more details)

PDB Description: Solution structure of the antigenic TB protein MPT70/MPB70

SCOP Domain Sequences for d1nyoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nyoa_ b.118.1.1 (A:) Immunogenic protein MPT70 {Mycobacterium tuberculosis}
gdlvgpgcaeyaaanptgpasvqgmsqdpvavaasnnpelttltaalsgqlnpqvnlvdt
lnsgqytvfaptnaafsklpastidelktnsslltsiltyhvvagqtspanvvgtrqtlq
gasvtvtgqgnslkvgnadvvcggvstanatvymidsvlmppa

SCOP Domain Coordinates for d1nyoa_:

Click to download the PDB-style file with coordinates for d1nyoa_.
(The format of our PDB-style files is described here.)

Timeline for d1nyoa_: