Lineage for d1nyef1 (1nye F:1021-1163)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240160Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 2240161Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 2240162Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 2240202Protein Osmotically inducible protein OsmC [103271] (1 species)
  7. 2240203Species Escherichia coli [TaxId:562] [103272] (2 PDB entries)
  8. 2240213Domain d1nyef1: 1nye F:1021-1163 [92343]
    Other proteins in same PDB: d1nyec2, d1nyed2, d1nyee2, d1nyef2
    structural genomics

Details for d1nyef1

PDB Entry: 1nye (more details), 2.4 Å

PDB Description: Crystal structure of OsmC from E. coli
PDB Compounds: (F:) Osmotically inducible protein C

SCOPe Domain Sequences for d1nyef1:

Sequence, based on SEQRES records: (download)

>d1nyef1 d.227.1.1 (F:1021-1163) Osmotically inducible protein OsmC {Escherichia coli [TaxId: 562]}
mtihkkgqahwegdikrgkgtvstesgvlnqqpygfntrfegekgtnpeeligaahaacf
smalslmlgeagftptsidttadvsldkvdagfaitkialksevavpgidastfdgiiqk
akagcpvsqvlkaeitldyqlks

Sequence, based on observed residues (ATOM records): (download)

>d1nyef1 d.227.1.1 (F:1021-1163) Osmotically inducible protein OsmC {Escherichia coli [TaxId: 562]}
mtihkkgqahwegdikrgkgtvstesgvlnqqpygfntrkgtnpeeligaahaacfsmal
slmlgeagftptsidttadvsldkvdagfaitkialksevavpgidastfdgiiqkakag
cpvsqvlkaeitldyqlks

SCOPe Domain Coordinates for d1nyef1:

Click to download the PDB-style file with coordinates for d1nyef1.
(The format of our PDB-style files is described here.)

Timeline for d1nyef1: